Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOF Peptide - middle region

APOF Peptide - middle region

Product Specifications

Product Name Alternative

LTIP, Apo-F

UniProt

Q13790

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001629.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRAISDVSDLEETTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIP13B (APPL2) Mouse Monoclonal Antibody [Clone ID: OTI1H8]
CF812384 100 µg

DIP13B (APPL2) Mouse Monoclonal Antibody [Clone ID: OTI1H8]

Sign In for Pricing
View Details
LC3A Antibody (MAP1LC3A)
F46104-0.08ML 0.08 mL

LC3A Antibody (MAP1LC3A)

Sign In for Pricing
View Details
HCG-beta (HCGb/54+ HCGb/459), CF660R conjugate, 0.1mg/mL
BNC611224-100 1x 100 µL

HCG-beta (HCGb/54+ HCGb/459), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Nuclear Antigen (235-1), CF405S conjugate, 0.1mg/mL
BNC040099-500 1x 500 µL

Human Nuclear Antigen (235-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FITC-Rabbit Anti-Mouse IgG
RD90798A-01 120 μL

FITC-Rabbit Anti-Mouse IgG

Sign In for Pricing
View Details
FITC-Rabbit Anti-Mouse IgG
RD90798A-02 500 µL

FITC-Rabbit Anti-Mouse IgG

Sign In for Pricing
View Details