Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPG Peptide - N-terminal region

CAPG Peptide - N-terminal region

Product Specifications

Product Name Alternative

MCP, AFCP, HEL-S-66

UniProt

P40121

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001243068.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Caspase-6 Antibody (M378)
NBP3-23183 0.1 mL

Mouse Monoclonal Caspase-6 Antibody (M378)

Sign In for Pricing
View Details
TIMM10 (NM_012456) Human Recombinant Protein
TP305668 20 µg

TIMM10 (NM_012456) Human Recombinant Protein

Sign In for Pricing
View Details
STOML3-set siRNA/shRNA/RNAi Lentivector (Human)
45762091 4x 500 ng

STOML3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
pEGFP-flag-LILRA5 Plasmid
PVTB00330-2a 2 µg

pEGFP-flag-LILRA5 Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Pde6c shRNA (UAS) - Lentiviral mouse Pde6c shRNA (UAS, GFP) plasmid
GTR15189970 1 Vial

Lentiviral mouse Pde6c shRNA (UAS) - Lentiviral mouse Pde6c shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human POLG knockout cell line
ABC-KH11867 1 Vial

Human POLG knockout cell line

Sign In for Pricing
View Details