Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPG Peptide - N-terminal region

CAPG Peptide - N-terminal region

Product Specifications

Product Name Alternative

MCP, AFCP, HEL-S-66

UniProt

P40121

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001243068.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Heparan Sulfate 3-O-Sulfotransferase 4 (HS3ST4) ELISA Kit
MBS9920486-01 48 Well

Mouse Heparan Sulfate 3-O-Sulfotransferase 4 (HS3ST4) ELISA Kit

Sign In for Pricing
View Details
Mouse Heparan Sulfate 3-O-Sulfotransferase 4 (HS3ST4) ELISA Kit
MBS9920486-02 96 Well

Mouse Heparan Sulfate 3-O-Sulfotransferase 4 (HS3ST4) ELISA Kit

Sign In for Pricing
View Details
Mouse Heparan Sulfate 3-O-Sulfotransferase 4 (HS3ST4) ELISA Kit
MBS9920486-03 5x 96 Well

Mouse Heparan Sulfate 3-O-Sulfotransferase 4 (HS3ST4) ELISA Kit

Sign In for Pricing
View Details
Mouse Heparan Sulfate 3-O-Sulfotransferase 4 (HS3ST4) ELISA Kit
MBS9920486-04 10x 96 Well

Mouse Heparan Sulfate 3-O-Sulfotransferase 4 (HS3ST4) ELISA Kit

Sign In for Pricing
View Details
C4orf33 (NM_173487) Human Recombinant Protein
TP307633M 100 µg

C4orf33 (NM_173487) Human Recombinant Protein

Sign In for Pricing
View Details
ASPA Rabbit Polyclonal Antibody
TA324873 400 µL

ASPA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details