Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP3A4 Peptide - N-terminal region

CYP3A4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HLP, CP33, CP34, CYP3A, NF-25, CYP3A3, P450C3, CYPIIIA3, CYPIIIA4, P450PCN1

UniProt

P08684

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001189784.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P Antibody (FITC)
abx300953-01 20 µg

P Antibody (FITC)

Sign In for Pricing
View Details
P Antibody (FITC)
abx300953-02 50 µg

P Antibody (FITC)

Sign In for Pricing
View Details
P Antibody (FITC)
abx300953-03 100 µg

P Antibody (FITC)

Sign In for Pricing
View Details
P Antibody (FITC)
abx300953-04 200 µg

P Antibody (FITC)

Sign In for Pricing
View Details
P Antibody (FITC)
abx300953-05 1 mg

P Antibody (FITC)

Sign In for Pricing
View Details
Lta sgRNA CRISPR Lentivector (Rat) (Target 2)
K6934403 1.0 µg DNA

Lta sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details