Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP11B2 Peptide - N-terminal region

CYP11B2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CPN2, ALDOS, CYP11B, CYP11BL, CYPXIB2, P450C18, P-450C18, P450aldo

UniProt

P19099

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000489.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-hsa-miR-4772-5p Vector
mh42048 500 ng

LentimiRa-hsa-miR-4772-5p Vector

Sign In for Pricing
View Details
PDIA3 Protein Vector (Human) (pPM-C-HA)
PV030555 500 ng

PDIA3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human Histone H1
MBS7609242-01 0.05 mg

Recombinant Human Histone H1

Sign In for Pricing
View Details
Recombinant Human Histone H1
MBS7609242-02 0.2 mg

Recombinant Human Histone H1

Sign In for Pricing
View Details
Recombinant Human Histone H1
MBS7609242-03 1 mg

Recombinant Human Histone H1

Sign In for Pricing
View Details
Recombinant Human Histone H1
MBS7609242-04 5x 1 mg

Recombinant Human Histone H1

Sign In for Pricing
View Details