Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP11B2 Peptide - N-terminal region

CYP11B2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CPN2, ALDOS, CYP11B, CYP11BL, CYPXIB2, P450C18, P-450C18, P450aldo

UniProt

P19099

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000489.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-Syvn1-HA-Neo Plasmid
PVT75190 2 µg

PCMV-Syvn1-HA-Neo Plasmid

Sign In for Pricing
View Details
Maged1 (NM_053409) Rat Tagged ORF Clone Lentiviral Particle
RR214811L3V 200 µL

Maged1 (NM_053409) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2'-Deoxy-5'-O-DMT-guanosine- (iBu) -succinyl CPG 1400 Å
ND11615-01 1000 mg

2'-Deoxy-5'-O-DMT-guanosine- (iBu) -succinyl CPG 1400 Å

Sign In for Pricing
View Details
2'-Deoxy-5'-O-DMT-guanosine- (iBu) -succinyl CPG 1400 Å
ND11615-02 5000 mg

2'-Deoxy-5'-O-DMT-guanosine- (iBu) -succinyl CPG 1400 Å

Sign In for Pricing
View Details
2'-Deoxy-5'-O-DMT-guanosine- (iBu) -succinyl CPG 1400 Å
ND11615-03 10000 mg

2'-Deoxy-5'-O-DMT-guanosine- (iBu) -succinyl CPG 1400 Å

Sign In for Pricing
View Details
CD4 (7B13) Rabbit Monoclonal Antibody
E28M3394 100 µL

CD4 (7B13) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details