Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DECR1 Peptide - C-terminal region

DECR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DECR, NADPH, SDR18C1

UniProt

Q16698

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001350.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMAC1L2 (SLC35G5) (N-term) Rabbit Polyclonal Antibody
AP50157PU-N 400 µL

AMAC1L2 (SLC35G5) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human alpha Fetoprotein Recombinant Rabbit monoclonal Antibody
HA723646B 100 µL

Human alpha Fetoprotein Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1792), CF405S conjugate, 0.1mg/mL
BNC041792-500 1x 500 µL

SOX2 (Transcription Factor) (SOX2/1792), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SCGN Recombinant Rabbit Monoclonal Antibody [JE60-48]
HA721891 100 µL

SCGN Recombinant Rabbit Monoclonal Antibody [JE60-48]

Sign In for Pricing
View Details
SNAPC3 (NM_001039697) Human Over-expression Lysate
LY421891 100 µg

SNAPC3 (NM_001039697) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS639784 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details