Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DECR1 Peptide - C-terminal region

DECR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DECR, NADPH, SDR18C1

UniProt

Q16698

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001350.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYVE1 (271-275) Rabbit Polyclonal Antibody
AP26047PU-S 50 µL

LYVE1 (271-275) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
tert-Butyl 8-Hydroxyoctanoate
TRC-B693225-250MG 250 mg

tert-Butyl 8-Hydroxyoctanoate

Sign In for Pricing
View Details
Recombinant Human Activin RIIA/ACVR2A Protein (Fc & His Tag)
PKSH032039-01 10 µg

Recombinant Human Activin RIIA/ACVR2A Protein (Fc & His Tag)

Sign In for Pricing
View Details
Recombinant Human Activin RIIA/ACVR2A Protein (Fc & His Tag)
PKSH032039-02 50 µg

Recombinant Human Activin RIIA/ACVR2A Protein (Fc & His Tag)

Sign In for Pricing
View Details
2-Amino-3-chlorobenzoic Acid
TRC-A603395-1G 1 g

2-Amino-3-chlorobenzoic Acid

Sign In for Pricing
View Details
Biotin Conjugated Lycopersicon esculentum Lectin (Tomato) -LEA-
BA-7001-1 1 mg

Biotin Conjugated Lycopersicon esculentum Lectin (Tomato) -LEA-

Sign In for Pricing
View Details