Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DFFA Peptide - middle region

DFFA Peptide - middle region

Product Specifications

Product Name Alternative

DFF1, ICAD, DFF-45

UniProt

O00273

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004392.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AFM/Afamin Protein (His Tag)
PKSH030684 50 µg

Recombinant Human AFM/Afamin Protein (His Tag)

Sign In for Pricing
View Details
Human PPP1R14C siRNA
abx904179-01 15 nmol

Human PPP1R14C siRNA

Sign In for Pricing
View Details
Human PPP1R14C siRNA
abx904179-02 30 nmol

Human PPP1R14C siRNA

Sign In for Pricing
View Details
Interleukin 5 (IL-5, BCDF-alpha, Eosinophil Differentiation Factor, EDF) (MaxLight 550)
MBS6482695-01 0.1 mL

Interleukin 5 (IL-5, BCDF-alpha, Eosinophil Differentiation Factor, EDF) (MaxLight 550)

Sign In for Pricing
View Details
Interleukin 5 (IL-5, BCDF-alpha, Eosinophil Differentiation Factor, EDF) (MaxLight 550)
MBS6482695-02 5x 0.1 mL

Interleukin 5 (IL-5, BCDF-alpha, Eosinophil Differentiation Factor, EDF) (MaxLight 550)

Sign In for Pricing
View Details
Compound NP-018511
MBS5794231 Inquire

Compound NP-018511

Sign In for Pricing
View Details