Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DFFA Peptide - middle region

DFFA Peptide - middle region

Product Specifications

Product Name Alternative

DFF1, ICAD, DFF-45

UniProt

O00273

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004392.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adam9 (NM_007404) Mouse Tagged Lenti ORF Clone
MR210932L4 10 µg

Adam9 (NM_007404) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat VEGF121 (Vascular Endothelial Growth Factor 121) ELISA Kit
ELK2969-01 48 Tests

Rat VEGF121 (Vascular Endothelial Growth Factor 121) ELISA Kit

Sign In for Pricing
View Details
Rat VEGF121 (Vascular Endothelial Growth Factor 121) ELISA Kit
ELK2969-02 96 Tests

Rat VEGF121 (Vascular Endothelial Growth Factor 121) ELISA Kit

Sign In for Pricing
View Details
Rat VEGF121 (Vascular Endothelial Growth Factor 121) ELISA Kit
ELK2969-03 5x 96 Tests

Rat VEGF121 (Vascular Endothelial Growth Factor 121) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS806817 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human FAM110B knockout cell line
ABC-KH5061 1 Vial

Human FAM110B knockout cell line

Sign In for Pricing
View Details