What is the catalog number for E2F3 Peptide - middle region?

The catalog number for E2F3 Peptide - middle region is orb2001614.

What sizes are available for E2F3 Peptide - middle region?

E2F3 Peptide - middle region is available in the following size(s): 100 µg.

Is E2F3 Peptide - middle region in stock?

E2F3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

E2F3 Peptide - middle region

Product Specifications

Product Name Alternative

E2F-3

UniProt

O00716

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001230005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S1012-52R-ML750 100 µL

Sex Hormone Binding Globulin (SHBG, Androgen Binding Protein, ABP, MGC126834, MGC138391, Sex Steroid-binding Protein, SBP, Testis-specific Androgen Binding Protein, Testosterone Binding beta Globulin, Testosterone-estradiol Binding Globulin, Testosterone-estrogen Binding Globulin, TeBG) (MaxLight 750) discontinued

Sign In for Pricing

View Details

abx725002 1 Unit

Smart Personal Micro Centrifuge

Sign In for Pricing

View Details

NBP2-50124IR 0.1 mL

Mouse Monoclonal BOP1 Antibody (T7-P1B7/A8) [DyLight 755]

Sign In for Pricing

View Details

CM11-01 10 µg

Recombinant Mouse TIMP-1

Sign In for Pricing

View Details

CM11-02 50 µg

Recombinant Mouse TIMP-1

Sign In for Pricing

View Details

CM11-03 500 µg

Recombinant Mouse TIMP-1

Sign In for Pricing

View Details