What is the catalog number for E2F3 Peptide - middle region?

The catalog number for E2F3 Peptide - middle region is orb2001614.

What sizes are available for E2F3 Peptide - middle region?

E2F3 Peptide - middle region is available in the following size(s): 100 µg.

Is E2F3 Peptide - middle region in stock?

E2F3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

E2F3 Peptide - middle region

Product Specifications

Product Name Alternative

E2F-3

UniProt

O00716

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001230005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-81864JF549 0.1 mL

Rabbit Polyclonal Thyroid receptor-interacting protein 12 Antibody [Janelia Fluor 549]

Sign In for Pricing

View Details

MBS130796-01 100 mg

SKF-86002

Sign In for Pricing

View Details

MBS130796-02 500 mg

SKF-86002

Sign In for Pricing

View Details

MR200257 10 µg

Gypc (NM_001048207) Mouse Tagged ORF Clone

Sign In for Pricing

View Details

orb2942596 10 mg

Erythrina Cristagalli Lectin

Sign In for Pricing

View Details

orb2902559-01 20 µg

Recombinant Human Histo-blood group ABO system transferase (ABO)

Sign In for Pricing

View Details