Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STOM Peptide - N-terminal region

STOM Peptide - N-terminal region

Product Specifications

Product Name Alternative

BND7, EPB7, EPB72

UniProt

P27105

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004090.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKRHTRDSEAQRLPDSFKDSPSKGLGPCGWILVAFSFLFTVITFPISIWM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG (Immunoglobulin Gamma Heavy Chain, G1m Marker, G2m Marker, G3m Marker, G4m Marker, HDC, Heavy Chain Disease Protein, Human Immunglobulin G, Ig gamma1/2/3/4 Chain C Region, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Heavy Constant 1/2/3/4) (HRP)
MBS6123316-01 0.1 mL

IgG (Immunoglobulin Gamma Heavy Chain, G1m Marker, G2m Marker, G3m Marker, G4m Marker, HDC, Heavy Chain Disease Protein, Human Immunglobulin G, Ig gamma1/2/3/4 Chain C Region, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Heavy Constant 1/2/3/4) (HRP)

Sign In for Pricing
View Details
IgG (Immunoglobulin Gamma Heavy Chain, G1m Marker, G2m Marker, G3m Marker, G4m Marker, HDC, Heavy Chain Disease Protein, Human Immunglobulin G, Ig gamma1/2/3/4 Chain C Region, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Heavy Constant 1/2/3/4) (HRP)
MBS6123316-02 5x 0.1 mL

IgG (Immunoglobulin Gamma Heavy Chain, G1m Marker, G2m Marker, G3m Marker, G4m Marker, HDC, Heavy Chain Disease Protein, Human Immunglobulin G, Ig gamma1/2/3/4 Chain C Region, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Heavy Constant 1/2/3/4) (HRP)

Sign In for Pricing
View Details
CIAPIN1 Antibody
OACA07918-100UL 100 µL

CIAPIN1 Antibody

Sign In for Pricing
View Details
RB1 Antibody
orb571247-01 50 µg

RB1 Antibody

Sign In for Pricing
View Details
RB1 Antibody
orb571247-02 100 µg

RB1 Antibody

Sign In for Pricing
View Details
DLX5 Antibody : HRP (OAAF02328-HRP)
OAAF02328-100UG-HRP 100 µg

DLX5 Antibody : HRP (OAAF02328-HRP)

Sign In for Pricing
View Details