Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF12 Peptide - N-terminal region

FGF12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FHF1, FGF12B

UniProt

P61328

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004104.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-C21orf59 Antibody
CTA4037-01 30 µL

Anti-C21orf59 Antibody

Sign In for Pricing
View Details
Anti-C21orf59 Antibody
CTA4037-02 50 μL

Anti-C21orf59 Antibody

Sign In for Pricing
View Details
Anti-C21orf59 Antibody
CTA4037-03 100 µL

Anti-C21orf59 Antibody

Sign In for Pricing
View Details
Anti-C21orf59 Antibody
CTA4037-04 200 µL

Anti-C21orf59 Antibody

Sign In for Pricing
View Details
Olr1548 (NM_001001108) Rat Tagged ORF Clone Lentiviral Particle
RR210868L3V 200 µL

Olr1548 (NM_001001108) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Nanog Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1588120 100 µL

Nanog Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details