What is the catalog number for FGF12 Peptide - N-terminal region?

The catalog number for FGF12 Peptide - N-terminal region is orb2001612.

What sizes are available for FGF12 Peptide - N-terminal region?

FGF12 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is FGF12 Peptide - N-terminal region in stock?

FGF12 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

FGF12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FHF1, FGF12B

UniProt

P61328

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004104.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

39472174 3x 5 nmol

Rgs16 siRNA Oligos set (Mouse)

Sign In for Pricing

View Details

orb386857 100 µL

EWSR1 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing

View Details

NBP1-71804CL1 0.1 mL

Rabbit Polyclonal TR2/NR2C1 Antibody [CoraFluor 1]

Sign In for Pricing

View Details

RP186665 100 µg

Zfp143 Recombinant Protein (Mouse)

Sign In for Pricing

View Details

MBS7039491-01 0.02 mg

Recombinant Rabies virus Glycoprotein G (G)

Sign In for Pricing

View Details

MBS7039491-02 0.1 mg

Recombinant Rabies virus Glycoprotein G (G)

Sign In for Pricing

View Details