Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-A Peptide - C-terminal region

HLA-A Peptide - C-terminal region

Product Specifications

Product Name Alternative

HLAA

UniProt

P30443

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001229687.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR9 CRISPRa sgRNA lentivector (set of three targets)(Human)
46784121 3x 1.0µg DNA

TLR9 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
IFITM3 monoclonal antibody
MB67067-01 50 µL

IFITM3 monoclonal antibody

Sign In for Pricing
View Details
IFITM3 monoclonal antibody
MB67067-02 100 µL

IFITM3 monoclonal antibody

Sign In for Pricing
View Details
DIR25 Antibody
orb787180 2 mg

DIR25 Antibody

Sign In for Pricing
View Details
Bictegravir (Standard)
HY-17605R-01 5 mg

Bictegravir (Standard)

Sign In for Pricing
View Details
Bictegravir (Standard)
HY-17605R-02 10 mg

Bictegravir (Standard)

Sign In for Pricing
View Details