What is the catalog number for HLA-A Peptide - C-terminal region?

The catalog number for HLA-A Peptide - C-terminal region is orb2001607.

What sizes are available for HLA-A Peptide - C-terminal region?

HLA-A Peptide - C-terminal region is available in the following size(s): 100 µg.

Is HLA-A Peptide - C-terminal region in stock?

HLA-A Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

HLA-A Peptide - C-terminal region

Product Specifications

Product Name Alternative

HLAA

UniProt

P30443

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001229687.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EF015042 96 Tests

Mouse Gne ELISA Kit

Sign In for Pricing

View Details

CR560845 5 µg

Tissue Total RNA, Lung

Sign In for Pricing

View Details

MR208573L3V 200 µL

Nrbp1 (NM_147201) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing

View Details

LV715148 1.0 µg DNA

SLC35A5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing

View Details

E19-7427 100 µg -100 µL

CCL5 Antibody

Sign In for Pricing

View Details

OR1043204-01 100 mg

Methyl 1-benzyl-4-hydroxypiperidine-4-carboxylate

Sign In for Pricing

View Details