What is the catalog number for ABLIM1 Peptide - middle region?

The catalog number for ABLIM1 Peptide - middle region is orb2001605.

What sizes are available for ABLIM1 Peptide - middle region?

ABLIM1 Peptide - middle region is available in the following size(s): 100 µg.

Is ABLIM1 Peptide - middle region in stock?

ABLIM1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ABLIM1 Peptide - middle region

Product Specifications

Product Name Alternative

ABLIM, LIMAB1, LIMATIN, abLIM-1

UniProt

O14639

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001003407.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NB600-249UV 0.1 mL

Rabbit Polyclonal KMT2A/MLL Antibody [DyLight 350]

Sign In for Pricing

View Details

TL712096V 500 µL Each

Rasgrf2 Rat shRNA Lentiviral Particle (Locus ID 114513)

Sign In for Pricing

View Details

TRV-0038206-01 10 µg

Recombinant Symplekin (SYMPK)

Sign In for Pricing

View Details

TRV-0038206-02 50 µg

Recombinant Symplekin (SYMPK)

Sign In for Pricing

View Details

TRV-0038206-03 100 µg

Recombinant Symplekin (SYMPK)

Sign In for Pricing

View Details

TRV-0038206-04 200 µg

Recombinant Symplekin (SYMPK)

Sign In for Pricing

View Details