Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABLIM1 Peptide - middle region

ABLIM1 Peptide - middle region

Product Specifications

Product Name Alternative

ABLIM, LIMAB1, LIMATIN, abLIM-1

UniProt

O14639

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001003407.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR1 Human shRNA Plasmid Kit (Locus ID 2260)
TR320354 1 Kit

FGFR1 Human shRNA Plasmid Kit (Locus ID 2260)

Sign In for Pricing
View Details
ELOVL4 Antibody BIOTIN-Conjugated
MBS541490-01 0.1 mg

ELOVL4 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
ELOVL4 Antibody BIOTIN-Conjugated
MBS541490-02 5x 0.1 mg

ELOVL4 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Glycerol-3-phosphate acyltransferase (plsY), partial
MBS7067200 Inquire

Recombinant Salmonella paratyphi A Glycerol-3-phosphate acyltransferase (plsY), partial

Sign In for Pricing
View Details
Anti-ALDH3A1 Antibody Picoband®, Dylight594 Conjugate
PA2074-Dylight594 100 µg

Anti-ALDH3A1 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
ANAPC7 Protein Vector (Rat) (pPM-C-HA)
11881026 500 ng

ANAPC7 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details