Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMO7 Peptide - middle region

LMO7 Peptide - middle region

Product Specifications

Product Name Alternative

LOMP, FBX20, FBXO20

UniProt

Q8WWI1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001293009.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEPKTALPFNRFLPNKSRQPSYVPAPLRKKKPDKHEDNRRSWASPVYTEA

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB9 (NM_012328) Human Tagged ORF Clone Lentiviral Particle
RC205128L4V 200 µL

DNAJB9 (NM_012328) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hoxb7 (NM_001017480) Rat Untagged Clone
RN210758 10 µg

Hoxb7 (NM_001017480) Rat Untagged Clone

Sign In for Pricing
View Details
RhoH antibody
70R-49396 100 ul

RhoH antibody

Sign In for Pricing
View Details
Recombinant Bovine Inhibin alpha chain (INHA)
CSB-EP011718BO-01 10 µg

Recombinant Bovine Inhibin alpha chain (INHA)

Sign In for Pricing
View Details
Recombinant Bovine Inhibin alpha chain (INHA)
CSB-EP011718BO-02 50 µg

Recombinant Bovine Inhibin alpha chain (INHA)

Sign In for Pricing
View Details
Recombinant Bovine Inhibin alpha chain (INHA)
CSB-EP011718BO-03 200 µg

Recombinant Bovine Inhibin alpha chain (INHA)

Sign In for Pricing
View Details