Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMO7 Peptide - middle region

LMO7 Peptide - middle region

Product Specifications

Product Name Alternative

LOMP, FBX20, FBXO20

UniProt

Q8WWI1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001293009.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEPKTALPFNRFLPNKSRQPSYVPAPLRKKKPDKHEDNRRSWASPVYTEA

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC2A4RG Human Gene Knockout Kit (CRISPR)
KN408570 1 Kit

SLC2A4RG Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CROT (Peroxisomal Carnitine O-Octanoyltransferase, COT) (APC)
125350-APC 100 µL

CROT (Peroxisomal Carnitine O-Octanoyltransferase, COT) (APC)

Sign In for Pricing
View Details
PRR9 Protein Vector (Mouse) (pPB-N-His)
PV219915 500 ng

PRR9 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Caspase 10 (CASP10)
MBS2052037-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Caspase 10 (CASP10)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Caspase 10 (CASP10)
MBS2052037-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Caspase 10 (CASP10)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Caspase 10 (CASP10)
MBS2052037-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Caspase 10 (CASP10)

Sign In for Pricing
View Details