Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSP1 Peptide - middle region

LSP1 Peptide - middle region

Product Specifications

Product Name Alternative

WP34, pp52

UniProt

P33241

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001013271.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LARP2 Protein Vector (Human) (pPB-N-His)
PV023366 500 ng

LARP2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral human CDC20 sgRNA gene knockout kit - Lentiviral human CDC20 sgRNA gene knockout kit (100)
GTR15385363 1 Vial

Lentiviral human CDC20 sgRNA gene knockout kit - Lentiviral human CDC20 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc - Biotin
CSA2204-01 100 µL

Goat Anti-Human IgG Fc - Biotin

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc - Biotin
CSA2204-02 500 μL

Goat Anti-Human IgG Fc - Biotin

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc - Biotin
CSA2204-03 1 mL

Goat Anti-Human IgG Fc - Biotin

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans Lipid A export ATP-binding/permease protein MsbA (msbA)
orb2913655-01 20 µg

Recombinant Saccharophagus degradans Lipid A export ATP-binding/permease protein MsbA (msbA)

Sign In for Pricing
View Details