Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSP1 Peptide - middle region

LSP1 Peptide - middle region

Product Specifications

Product Name Alternative

WP34, pp52

UniProt

P33241

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001013271.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acid Blue 45 (Technical Grade)
TRC-A189833-25G 25 g

Acid Blue 45 (Technical Grade)

Sign In for Pricing
View Details
EpCAM Recombinant Rabbit monoclonal Antibody
HA750703 100 µL

EpCAM Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
RAP1A (NM_002884) Human Over-expression Lysate
LY419031 100 µg

RAP1A (NM_002884) Human Over-expression Lysate

Sign In for Pricing
View Details
Abcg2 Mouse Gene Knockout Kit (CRISPR)
KN500640 1 Kit

Abcg2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IGFBP3 (NM_000598) Human Over-expression Lysate
LY424615 100 µg

IGFBP3 (NM_000598) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Prostate
CR560638 5 µg

Tissue Total RNA, Prostate

Sign In for Pricing
View Details