Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MATN2 Peptide - C-terminal region

MATN2 Peptide - C-terminal region

Product Specifications

UniProt

O00339

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002371.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ICEALEDSDGRQDSPAGELPKTVQQPTESEPVTINIQDLLSCSNFAVQHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc7 Polyclonal Antibody, APC Conjugated
bs-5148R-APC-TR 20 µL

Cdc7 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Sheep 5'-Nucleotidase, Ecto ELISA Kit
MBS081405-01 48 Well

Sheep 5'-Nucleotidase, Ecto ELISA Kit

Sign In for Pricing
View Details
Sheep 5'-Nucleotidase, Ecto ELISA Kit
MBS081405-02 96 Well

Sheep 5'-Nucleotidase, Ecto ELISA Kit

Sign In for Pricing
View Details
Sheep 5'-Nucleotidase, Ecto ELISA Kit
MBS081405-03 5x 96 Well

Sheep 5'-Nucleotidase, Ecto ELISA Kit

Sign In for Pricing
View Details
Sheep 5'-Nucleotidase, Ecto ELISA Kit
MBS081405-04 10x 96 Well

Sheep 5'-Nucleotidase, Ecto ELISA Kit

Sign In for Pricing
View Details
FN3K Protein Vector (Human) (pPB-C-His)
PV016533 500 ng

FN3K Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details