MC4R Peptide - N-terminal region
MC4R Peptide - N-terminal region
Product Specifications
UniProt
P32245
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_005903.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2088991-01 5x 96 Tests
Human Integrin Beta 1 (ITGb1) ELISA Kit DIY Materials
Sign In for Pricing
View Details MBS2088991-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)
Human Integrin Beta 1 (ITGb1) ELISA Kit DIY Materials
Sign In for Pricing
View Details MBS2088991-03 10x 96 Tests
Human Integrin Beta 1 (ITGb1) ELISA Kit DIY Materials
Sign In for Pricing
View Details MBS2088991-04 10x 96 Tests + MBS2089471 (Support Pack 1, 10x 96 Tests)
Human Integrin Beta 1 (ITGb1) ELISA Kit DIY Materials
Sign In for Pricing
View Details 