What is the catalog number for MC4R Peptide - N-terminal region?

The catalog number for MC4R Peptide - N-terminal region is orb2001593.

What sizes are available for MC4R Peptide - N-terminal region?

MC4R Peptide - N-terminal region is available in the following size(s): 100 µg.

Is MC4R Peptide - N-terminal region in stock?

MC4R Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MC4R Peptide - N-terminal region

Product Specifications

UniProt

P32245

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005903.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

17646034 100 µg

DAGLB Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing

View Details

T73905 1 mg

SN-38 glucuronide

Sign In for Pricing

View Details

483786 100 µL

ITPK1 (Inositol-Tetrakisphosphate 1-Kinase)

Sign In for Pricing

View Details

TL504527V 500 µL Each

Golga7b Mouse shRNA Lentiviral Particle (Locus ID 71146)

Sign In for Pricing

View Details

444452-01 25 mg

Chlorprothixene

Sign In for Pricing

View Details

444452-02 50 mg

Chlorprothixene

Sign In for Pricing

View Details