Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC4R Peptide - N-terminal region

MC4R Peptide - N-terminal region

Product Specifications

UniProt

P32245

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005903.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIV capsid modulator 2
orb3134412-01 10 mg

HIV capsid modulator 2

Sign In for Pricing
View Details
HIV capsid modulator 2
orb3134412-02 50 mg

HIV capsid modulator 2

Sign In for Pricing
View Details
Bax Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-0127R-BF750-TR 20 µL

Bax Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
KANSL2 Antibody - middle region
ARP68664_P050-25UL 25 µL

KANSL2 Antibody - middle region

Sign In for Pricing
View Details
Human SERPINF1/PEDF/Serpin F1 Recombinant Protein
PPT-15202 100 µg

Human SERPINF1/PEDF/Serpin F1 Recombinant Protein

Sign In for Pricing
View Details
GOT1 (Glutamate Oxaloacetate Transaminase 1, cCAT, GIG18, cAspAT, ASTQTL1) (HRP)
MBS6418954-01 0.1 mL

GOT1 (Glutamate Oxaloacetate Transaminase 1, cCAT, GIG18, cAspAT, ASTQTL1) (HRP)

Sign In for Pricing
View Details