Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFV2 Peptide - middle region

NDUFV2 Peptide - middle region

Product Specifications

Product Name Alternative

CI-24k

UniProt

P19404

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066552.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20a-Acetoxy-5b-pregnan-3a-ol-d5
TRC-A165152-2.5MG 2.5 mg

20a-Acetoxy-5b-pregnan-3a-ol-d5

Sign In for Pricing
View Details
Rps7 Mouse Gene Knockout Kit (CRISPR)
KN515117 1 Kit

Rps7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VDAC2 Human Gene Knockout Kit (CRISPR)
KN220035 1 Kit

VDAC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TOMM20 Recombinant Rabbit Monoclonal Antibody [ST04-72]
ET1609-25 100 µL

TOMM20 Recombinant Rabbit Monoclonal Antibody [ST04-72]

Sign In for Pricing
View Details
LLGL1 Human Gene Knockout Kit (CRISPR)
KN417078 1 Kit

LLGL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-cyclohexylhexanoic Acid
TRC-C994565-50MG 50 mg

6-cyclohexylhexanoic Acid

Sign In for Pricing
View Details