Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFV2 Peptide - middle region

NDUFV2 Peptide - middle region

Product Specifications

Product Name Alternative

CI-24k

UniProt

P19404

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066552.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon: sigmoid
CB618180 1 Block

Frozen Tissue Blocks, Colon: sigmoid

Sign In for Pricing
View Details
Rab4A Recombinant Rabbit Monoclonal Antibody [SR27-08]
ET1602-15 100 µL

Rab4A Recombinant Rabbit Monoclonal Antibody [SR27-08]

Sign In for Pricing
View Details
Nucleophosmin (NPM1) (NM_002520) Human Over-expression Lysate
LY419282 100 µg

Nucleophosmin (NPM1) (NM_002520) Human Over-expression Lysate

Sign In for Pricing
View Details
Heparan SULfate Proteoglycan 2 (HSPG2) Human Gene Knockout Kit (CRISPR)
KN223950LP 1 Kit

Heparan SULfate Proteoglycan 2 (HSPG2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GJD2 (C-term) Rabbit Polyclonal Antibody
AP11584PU-N 400 µL

GJD2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PALB2 activation kit by CRISPRa
GA112582 1 Kit

Human PALB2 activation kit by CRISPRa

Sign In for Pricing
View Details