NOP2 Peptide - C-terminal region
NOP2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
NOL1, p120, NSUN1, NOP120
UniProt
P46087
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001028886.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PEQPFEKAAFQKQNDTPKGPQPPTVSPIRSSRPPPAKRKKSQSRGNSQLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941097-500 1x 500 µL
CD44 Standard (HCAM/1097), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![N4-[5-[[4-[[5-(Acetylhydroxyamino)pentyl]amino]-1,4-dioxobutyl]hydroxyamino]pentyl]-N1-[5-[[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]amino]pentyl]-N1-hydroxybutanediamide](https://cdn.genprice.uk/products/572/8997097259042/imageurl/trc-a179115-5mg.webp)
TRC-A179115-5MG 5 mg
N4-[5-[[4-[[5-(Acetylhydroxyamino)pentyl]amino]-1,4-dioxobutyl]hydroxyamino]pentyl]-N1-[5-[[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]amino]pentyl]-N1-hydroxybutanediamide
Sign In for Pricing
View Details 
BNC682418-500 1x 500 µL
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742046-500 1x 500 µL
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC402059 20 µg
Retinoid X Receptor gamma (RXRG) (NM_006917) Human Over-expression Lysate
Sign In for Pricing
View Details