Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOP2 Peptide - C-terminal region

NOP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NOL1, p120, NSUN1, NOP120

UniProt

P46087

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001028886.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEQPFEKAAFQKQNDTPKGPQPPTVSPIRSSRPPPAKRKKSQSRGNSQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR561047 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
1,4-Dibutyl Benzene-1,4-dicarboxylate
TRC-D159391-1G 1 g

1,4-Dibutyl Benzene-1,4-dicarboxylate

Sign In for Pricing
View Details
Meconic Acid
TRC-M202890-25MG 25 mg

Meconic Acid

Sign In for Pricing
View Details
NBPF4 Human Gene Knockout Kit (CRISPR)
KN427208 1 Kit

NBPF4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPL13 (NM_033251) Human Recombinant Protein
TP303412 20 µg

RPL13 (NM_033251) Human Recombinant Protein

Sign In for Pricing
View Details
Rat IgG (Fab Fragment specific), AlpHcAbs® Goat
HA710321 100 µg

Rat IgG (Fab Fragment specific), AlpHcAbs® Goat

Sign In for Pricing
View Details