Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPTX1 Peptide - middle region

NPTX1 Peptide - middle region

Product Specifications

Product Name Alternative

NP1

UniProt

Q15818

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002513.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Alanyl-L-leucine
TRC-A576310-50MG 50 mg

L-Alanyl-L-leucine

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF488A conjugate, 0.1mg/mL
BNC882052-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PerCP-iFluor® 700
2651-AAT 1 mg

PerCP-iFluor® 700

Sign In for Pricing
View Details
FAM13B1 (FAM13B) (Center) Rabbit Polyclonal Antibody
AP51498PU-N 400 µL

FAM13B1 (FAM13B) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APRIL Antibody (Biotin)
KB-22942-01 50 μL

APRIL Antibody (Biotin)

Sign In for Pricing
View Details
APRIL Antibody (Biotin)
KB-22942-02 100 µL

APRIL Antibody (Biotin)

Sign In for Pricing
View Details