Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBP Peptide - middle region

OSBP Peptide - middle region

Product Specifications

Product Name Alternative

OSBP1

UniProt

P22059

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002547.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QTRTD1 (QTRT2) (NM_024638) Human Recombinant Protein
TP306325L 1 mg

QTRTD1 (QTRT2) (NM_024638) Human Recombinant Protein

Sign In for Pricing
View Details
GABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody
TA367507 100 µL

GABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human DYNLT3 activation kit by CRISPRa
GA104806 1 Kit

Human DYNLT3 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Aminopiperidin-2-one (Technical Grade)
TRC-A577142-500MG 500 mg

3-Aminopiperidin-2-one (Technical Grade)

Sign In for Pricing
View Details
HBM (NM_001003938) Human Recombinant Protein
TP307833M 100 µg

HBM (NM_001003938) Human Recombinant Protein

Sign In for Pricing
View Details
TEAD3 Polyclonal Antibody
E-AB-52887-01 20 µL

TEAD3 Polyclonal Antibody

Sign In for Pricing
View Details