Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBP Peptide - middle region

OSBP Peptide - middle region

Product Specifications

Product Name Alternative

OSBP1

UniProt

P22059

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002547.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR / p504S (Rabbit PAb), CF640R conjugate, 0.1mg/mL
BNC400731-500 1x 500 µL

AMACR / p504S (Rabbit PAb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRPL22 Polyclonal Antibody
E-AB-90893-01 60 µL

MRPL22 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL22 Polyclonal Antibody
E-AB-90893-02 120 µL

MRPL22 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL22 Polyclonal Antibody
E-AB-90893-03 200 µL

MRPL22 Polyclonal Antibody

Sign In for Pricing
View Details
Swabzymes-Oxidase Reagent Swabs
13-106-50 1 Each

Swabzymes-Oxidase Reagent Swabs

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), Biotin conjugate, 0.1mg/mL
BNCB0486-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details