Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD2 Peptide - middle region

PDCD2 Peptide - middle region

Product Specifications

Product Name Alternative

RP8, ZMYND7

UniProt

Q16342

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001186391.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CAGLRVFRNQLPRKNDFYSYEPPSENPPPETGESVCLQLKSGAHLCRVCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gamma Catenin Rabbit mAb
orb2706955-01 20 ul

Gamma Catenin Rabbit mAb

Sign In for Pricing
View Details
Gamma Catenin Rabbit mAb
orb2706955-02 50 µL

Gamma Catenin Rabbit mAb

Sign In for Pricing
View Details
Gamma Catenin Rabbit mAb
orb2706955-03 100 µL

Gamma Catenin Rabbit mAb

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgG (H&L) - AcalephFluor405
CSA3127-01 100 µL

Rabbit Anti-Mouse IgG (H&L) - AcalephFluor405

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgG (H&L) - AcalephFluor405
CSA3127-02 500 μL

Rabbit Anti-Mouse IgG (H&L) - AcalephFluor405

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgG (H&L) - AcalephFluor405
CSA3127-03 1 mL

Rabbit Anti-Mouse IgG (H&L) - AcalephFluor405

Sign In for Pricing
View Details