Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX12 Peptide - middle region

PEX12 Peptide - middle region

Product Specifications

Product Name Alternative

PAF-3, PBD3A

UniProt

O00623

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000277.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Citric acid anhydrous, powdered pure EP, USP (pharma grade)
LC-6594.1 1 Kg

Citric acid anhydrous, powdered pure EP, USP (pharma grade)

Sign In for Pricing
View Details
ATP6V1E2 Protein Vector (Human) (pPB-His-MBP)
PV325498 500 ng

ATP6V1E2 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
3 5-Dibromopyridine 98%
D10490 5 g

3 5-Dibromopyridine 98%

Sign In for Pricing
View Details
Recombinant Human TROP-2 Protein
orb2993769-01 10 µg

Recombinant Human TROP-2 Protein

Sign In for Pricing
View Details
Recombinant Human TROP-2 Protein
orb2993769-02 50 µg

Recombinant Human TROP-2 Protein

Sign In for Pricing
View Details
Recombinant Human TROP-2 Protein
orb2993769-03 500 µg

Recombinant Human TROP-2 Protein

Sign In for Pricing
View Details