Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFKFB2 Peptide - C-terminal region

PFKFB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PFK-2/FBPase-2

UniProt

O60825

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001018063.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-Glu(OBzl)-OH
TRC-B391800-5G 5 g

Boc-Glu(OBzl)-OH

Sign In for Pricing
View Details
GPR32 Human Gene Knockout Kit (CRISPR)
KN209670BN 1 Kit

GPR32 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PMP22 (NM_153322) Human Over-expression Lysate
LC403508 20 µg

PMP22 (NM_153322) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse CXCL10 (IP-10)
6564 5 µg

Recombinant Mouse CXCL10 (IP-10)

Sign In for Pricing
View Details
2-Phenoxybenzoic Acid
TRC-P399413-50G 50 g

2-Phenoxybenzoic Acid

Sign In for Pricing
View Details
Recombinant Human TROP2/TACSTD2 Protein (aa 88-274, His Tag)
PKSH033482-01 10 µg

Recombinant Human TROP2/TACSTD2 Protein (aa 88-274, His Tag)

Sign In for Pricing
View Details