Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFKFB2 Peptide - C-terminal region

PFKFB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PFK-2/FBPase-2

UniProt

O60825

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001018063.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Frat1 activation kit by CRISPRa
GA201472 1 Kit

Mouse Frat1 activation kit by CRISPRa

Sign In for Pricing
View Details
TRAPPC3 Antibody
8C19146-AAT 50 µg

TRAPPC3 Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: left
CB617816 1 Block

Frozen Tissue Blocks, Ovary: left

Sign In for Pricing
View Details
Human XKR5 activation kit by CRISPRa
GA118063 1 Kit

Human XKR5 activation kit by CRISPRa

Sign In for Pricing
View Details
c Abl (ABL1) Rabbit Polyclonal Antibody
AP21010PU-N 100 µg

c Abl (ABL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fukutin (FKTN) (NM_001079802) Human Over-expression Lysate
LY421539 100 µg

Fukutin (FKTN) (NM_001079802) Human Over-expression Lysate

Sign In for Pricing
View Details