Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGAM1 Peptide - middle region

PGAM1 Peptide - middle region

Product Specifications

Product Name Alternative

PGAMA, PGAM-B, HEL-S-35

UniProt

P18669

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002620.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-rno-mir-150 Virus
mr0062 250 µL

AdmiRa-rno-mir-150 Virus

Sign In for Pricing
View Details
GM2A Protein Vector (Mouse) (pPB-C-His)
PV183774 500 ng

GM2A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Galectin 3,GAL3 ELISA KIT
JOT-EK1758Mo-01 48 Well

Mouse Galectin 3,GAL3 ELISA KIT

Sign In for Pricing
View Details
Mouse Galectin 3,GAL3 ELISA KIT
JOT-EK1758Mo-02 96 Well

Mouse Galectin 3,GAL3 ELISA KIT

Sign In for Pricing
View Details
Bpi Mouse Pre-designed siRNA Set A
HY-RS18324 1 Set

Bpi Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Monoclonal Antibody to Hearttype Fatty Acid Binding Protein (HFABP)
MBS2138874-01 0.1 mL

Monoclonal Antibody to Hearttype Fatty Acid Binding Protein (HFABP)

Sign In for Pricing
View Details