Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB13 Peptide - middle region

SERPINB13 Peptide - middle region

Product Specifications

Product Name Alternative

HUR7, PI13, headpin, HSHUR7SEQ

UniProt

Q9UIV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001294852.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps11 (BC012641) Mouse Tagged ORF Clone
MG201196 10 µg

Rps11 (BC012641) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ARHGEF11 Human Gene Knockout Kit (CRISPR)
KN208729 1 Kit

ARHGEF11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human GALNT7 activation kit by CRISPRa
GA109996 1 Kit

Human GALNT7 activation kit by CRISPRa

Sign In for Pricing
View Details
Orbi-Shaker™ MP with 4 position micro plate platform, 100-240V (US Plug)
BT1502 1 Each

Orbi-Shaker™ MP with 4 position micro plate platform, 100-240V (US Plug)

Sign In for Pricing
View Details
ART3 (NM_001130016) Human Over-expression Lysate
LC427105 20 µg

ART3 (NM_001130016) Human Over-expression Lysate

Sign In for Pricing
View Details
Antibody Coating Buffer, 5X
644 100 mL

Antibody Coating Buffer, 5X

Sign In for Pricing
View Details