Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB13 Peptide - middle region

SERPINB13 Peptide - middle region

Product Specifications

Product Name Alternative

HUR7, PI13, headpin, HSHUR7SEQ

UniProt

Q9UIV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001294852.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Epb42 activation kit by CRISPRa
GA201254 1 Kit

Mouse Epb42 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Nogo A (RTN4) activation kit by CRISPRa
GA111402 1 Kit

Human Nogo A (RTN4) activation kit by CRISPRa

Sign In for Pricing
View Details
Diisopropyl Sebacate
TRC-D525793-500MG 500 mg

Diisopropyl Sebacate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701520 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
IKB alpha (NFKBIA) Rabbit Polyclonal Antibody
AP02651PU-N 100 µL

IKB alpha (NFKBIA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTP synthase (CTPS1) Rabbit Monoclonal Antibody
TA424408 100 µL

CTP synthase (CTPS1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details