What is the catalog number for PLEK Peptide - N-terminal region?

The catalog number for PLEK Peptide - N-terminal region is orb2001577.

What sizes are available for PLEK Peptide - N-terminal region?

PLEK Peptide - N-terminal region is available in the following size(s): 100 µg.

Is PLEK Peptide - N-terminal region in stock?

PLEK Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PLEK Peptide - N-terminal region

Product Specifications

Product Name Alternative

P47

UniProt

P08567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002655.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D1236057Par 50 µg

Genomic DNA - Parkinson's Disease: Brain: Medulla oblongata, from a single donor

Sign In for Pricing

View Details

NBP2-50524JF549 0.1 mL

Mouse Monoclonal Myofibroblast Marker Antibody (PR 2D3) [Janelia Fluor 549]

Sign In for Pricing

View Details

ORF066252 1.0 µg DNA

Duox1 ORF Vector (Rat) (pORF)

Sign In for Pricing

View Details

orb830147 2 mg

YebO Antibody

Sign In for Pricing

View Details

19200031 100 µg

ELF2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing

View Details

C16107-5mg 5 mg

BTZ043 Racemate

Sign In for Pricing

View Details