Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEK Peptide - N-terminal region

PLEK Peptide - N-terminal region

Product Specifications

Product Name Alternative

P47

UniProt

P08567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002655.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine LTF ELISA Kit (Ready to Use)
orb549377-01 48 Tests

Canine LTF ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Canine LTF ELISA Kit (Ready to Use)
orb549377-02 96 Tests

Canine LTF ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
ODF4 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2523016 100 µL

ODF4 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
PKR shRNA (m) Lentiviral Particles
sc-36264-V 200 µL

PKR shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
LRRC45 Protein Vector (Mouse) (pPM-C-HA)
PV197692 500 ng

LRRC45 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Calcium Chloride Solution 5M
40120702-1 500 mL

Calcium Chloride Solution 5M

Sign In for Pricing
View Details