PPP2CA Peptide - middle region
PPP2CA Peptide - middle region
Product Specifications
Product Name Alternative
RP-C, PP2Ac, PP2CA, PP2Calpha
UniProt
P67775
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_002706.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
T0783 1x106 cells / 1.0 mL
Immortalized Human Adult Brain Astrocytes (AST-1)
Sign In for Pricing
View Details K7201706 1.0 µg DNA
Polr3d sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
VAng-Wyb3244-1mgEcoli 1 mg (E. coli)
Recombinant HPV-42 L2 (aa 1-477) Protein
Sign In for Pricing
View Details 
E2204-22 50 µg
EDEM2 (ER Degradation-enhancing alpha-mannosidase-like 2, C20orf31, C20orf49, UNQ573/PRO1135) discontinued
Sign In for Pricing
View Details A05569-1-Dylight488 100 µg
Anti-GJA4 Antibody Picoband® (Dylight488 Conjugate)
Sign In for Pricing
View Details GTR15367943 1 Vial
Lentiviral human ONECUT2 sgRNA gene knockout kit - Lentiviral human ONECUT2 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details