Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2CA Peptide - middle region

PPP2CA Peptide - middle region

Product Specifications

Product Name Alternative

RP-C, PP2Ac, PP2CA, PP2Calpha

UniProt

P67775

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002706.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaMKII (pan) (D11A10) Rabbit Monoclonal Antibody
CST 4436S 100 µL

CaMKII (pan) (D11A10) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NAF1 AAV Vector (Human) (CMV)
31397101 1 µg

NAF1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
anti-TRIM25
YF-PA15424 100 ul

anti-TRIM25

Sign In for Pricing
View Details
Rabbit Monoclonal VPS24 Antibody (SR1492)
NBP3-22183-100ul 100 µL

Rabbit Monoclonal VPS24 Antibody (SR1492)

Sign In for Pricing
View Details
2-[2- (Fmoc-amino) ethoxy]ethylamine Hydrochloride
414660-01 25 mg

2-[2- (Fmoc-amino) ethoxy]ethylamine Hydrochloride

Sign In for Pricing
View Details
2-[2- (Fmoc-amino) ethoxy]ethylamine Hydrochloride
414660-02 50 mg

2-[2- (Fmoc-amino) ethoxy]ethylamine Hydrochloride

Sign In for Pricing
View Details