Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R1B Peptide - N-terminal region

PPP2R1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

PR65B, PP2A-Abeta

UniProt

P30154

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001171033.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD109 (Cluster of Differentiation 109) ELISA Kit
E-EL-H6276-01 24 Tests

Human CD109 (Cluster of Differentiation 109) ELISA Kit

Sign In for Pricing
View Details
Human CD109 (Cluster of Differentiation 109) ELISA Kit
E-EL-H6276-02 48 Tests

Human CD109 (Cluster of Differentiation 109) ELISA Kit

Sign In for Pricing
View Details
Human CD109 (Cluster of Differentiation 109) ELISA Kit
E-EL-H6276-03 96 Tests

Human CD109 (Cluster of Differentiation 109) ELISA Kit

Sign In for Pricing
View Details
PE Anti-Human CD74 Antibody[LN2]
E-AB-F1072D-01 20 Tests

PE Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details
PE Anti-Human CD74 Antibody[LN2]
E-AB-F1072D-02 100 Tests

PE Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details
PE Anti-Human CD74 Antibody[LN2]
E-AB-F1072D-03 2x 100 Tests

PE Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details