Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R1B Peptide - N-terminal region

PPP2R1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

PR65B, PP2A-Abeta

UniProt

P30154

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001171033.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAX Antibody
KC-6156-01 50 μL

BAX Antibody

Sign In for Pricing
View Details
BAX Antibody
KC-6156-02 100 µL

BAX Antibody

Sign In for Pricing
View Details
BAX Antibody
KC-6156-03 1 mL

BAX Antibody

Sign In for Pricing
View Details
Caspase-10 Antibody
KC-7926-01 50 μL

Caspase-10 Antibody

Sign In for Pricing
View Details
Caspase-10 Antibody
KC-7926-02 100 µL

Caspase-10 Antibody

Sign In for Pricing
View Details
Caspase-10 Antibody
KC-7926-03 1 mL

Caspase-10 Antibody

Sign In for Pricing
View Details