Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R5B Peptide - middle region

PPP2R5B Peptide - middle region

Product Specifications

Product Name Alternative

B56B, PR61B

UniProt

Q15173

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_006235.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGVLIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR561504 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
CD68 (LAMP4/824), CF405S conjugate, 0.1mg/mL
BNC040824-500 1x 500 µL

CD68 (LAMP4/824), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OB Cadherin (CDH11) (NM_001797) Human Recombinant Protein
TP303810L 1 mg

OB Cadherin (CDH11) (NM_001797) Human Recombinant Protein

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF740 conjugate, 0.1mg/mL
BNC742062-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Malt1 (NM_172833) Mouse Over-expression Lysate
LC724110 20 µg

Malt1 (NM_172833) Mouse Over-expression Lysate

Sign In for Pricing
View Details
BMP6 Mouse Monoclonal Antibody [Clone ID: OTI6G9]
CF812286 100 µg

BMP6 Mouse Monoclonal Antibody [Clone ID: OTI6G9]

Sign In for Pricing
View Details