Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R5B Peptide - middle region

PPP2R5B Peptide - middle region

Product Specifications

Product Name Alternative

B56B, PR61B

UniProt

Q15173

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_006235.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGVLIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camsap2 Mouse Gene Knockout Kit (CRISPR)
KN502491 1 Kit

Camsap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD105 Antibody
KC-3429-01 50 μL

CD105 Antibody

Sign In for Pricing
View Details
CD105 Antibody
KC-3429-02 100 µL

CD105 Antibody

Sign In for Pricing
View Details
CD105 Antibody
KC-3429-03 1 mL

CD105 Antibody

Sign In for Pricing
View Details
Iodoethane (Stabilized with Copper)
TRC-I705870-10G 10 g

Iodoethane (Stabilized with Copper)

Sign In for Pricing
View Details
6-Bromohexene
TRC-B681930-25G 25 g

6-Bromohexene

Sign In for Pricing
View Details