Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK10 Peptide - middle region

MAPK10 Peptide - middle region

Product Specifications

Product Name Alternative

JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK

UniProt

P53779

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002744.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVV

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTHFS Knockout NCI-H1299 Polyclonal Cells
ARG18002 1 Million

MTHFS Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Olfr183 (NM_146485) Mouse Untagged Clone
MC213654 10 µg

Olfr183 (NM_146485) Mouse Untagged Clone

Sign In for Pricing
View Details
GluR1 Polyclonal Antibody, Cy7 Conjugated
bs-10042R-Cy7 100 µL

GluR1 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
HYAS2 Rabbit Polyclonal Antibody
orb507566 100 µg

HYAS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IRAG2/LRMP Protein (C-His)
32-9924-500 500 µg

Recombinant Human IRAG2/LRMP Protein (C-His)

Sign In for Pricing
View Details
Cd86 Rat shRNA Lentiviral Particle (Locus ID 56822)
TL710397V 500 µL Each

Cd86 Rat shRNA Lentiviral Particle (Locus ID 56822)

Sign In for Pricing
View Details