Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK10 Peptide - middle region

MAPK10 Peptide - middle region

Product Specifications

Product Name Alternative

JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK

UniProt

P53779

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002744.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tfap2c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7547605 3x 1.0 µg

Tfap2c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
25/100 bp mixed DNA Ladder
D-1020 500 μL

25/100 bp mixed DNA Ladder

Sign In for Pricing
View Details
Mouse Adh5 activation kit by CRISPRa
GA200085 1 Kit

Mouse Adh5 activation kit by CRISPRa

Sign In for Pricing
View Details
IGF1R Rabbit Monoclonal Antibody
E28G1585 100 µL

IGF1R Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SOX10 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1576687 100 µL

SOX10 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
SGMS1, NT (SGMS1, MOB, SMS1, TMEM23, Phosphatidylcholine:ceramide cholinephosphotransferase 1, Medulla oblongata-derived protein, Sphingomyelin synthase 1, Transmembrane protein 23) (MaxLight 405)
MBS6347004-01 0.1 mL

SGMS1, NT (SGMS1, MOB, SMS1, TMEM23, Phosphatidylcholine:ceramide cholinephosphotransferase 1, Medulla oblongata-derived protein, Sphingomyelin synthase 1, Transmembrane protein 23) (MaxLight 405)

Sign In for Pricing
View Details